- More Files
- Specification
Product Description
Human YBX1 full-length ORF ( NP_004550.2, 1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
62.3
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — YBX1
Entrez GeneID
4904GeneBank Accession#
NM_004559.3Protein Accession#
NP_004550.2Gene Name
YBX1
Gene Alias
BP-8, CSDA2, CSDB, DBPB, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP-1, NSEP1, YB-1, YB1
Gene Description
Y box binding protein 1
Omim ID
154030Gene Ontology
HyperlinkGene Summary
class II
Other Designations
DNA-binding protein B|OTTHUMP00000008731|major histocompatibility complex, class II, Y box-binding protein I|nuclease sensitive element binding protein 1
- Interactome
- Publication Reference
- Y-box binding protein 1 and RNase UK114 mediate monocyte chemoattractant protein 1 mRNA stability in vascular smooth muscle cells.
Dhawan L, Liu B, Pytlak A, Kulshrestha S, Blaxall BC, Taubman MB.
Molecular and Cellular Biology 2012 Sep; 32(18):3768.
Application:Func, Recombinant protein.
- Y-box binding protein 1 and RNase UK114 mediate monocyte chemoattractant protein 1 mRNA stability in vascular smooth muscle cells.