PHF19 Antibody - C-terminal region : FITC
Katalog-Nummer ARP50354_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-PHF19 (ARP50354_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Yeast, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PHF19 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100%; Yeast: 92%; Zebrafish: 79% |
Peptide Sequence | Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PHF19 (ARP50354_P050-FITC) antibody is Catalog # AAP50354 (Previous Catalog # AAPS26404) |
Reference | Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
---|---|
Gene Symbol | PHF19 |
Gene Full Name | PHD finger protein 19 |
Alias Symbols | PCL3, MTF2L1, TDRD19B |
NCBI Gene Id | 26147 |
Protein Name | PHD finger protein 19 |
Description of Target | PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter. |
Uniprot ID | Q5T6S3-2 |
Protein Accession # | NP_001009936 |
Nucleotide Accession # | NM_001009936 |
Protein Size (# AA) | 207 |
Molecular Weight | 22kDa |
Protein Interactions | SUZ12; EZH2; SUV39H2; KDM1A; SUV39H1; HIC1; PHF19; EED; |