PHF19 Antibody - C-terminal region : FITC

Katalog-Nummer ARP50354_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

PHF19 Antibody - C-terminal region : FITC (ARP50354_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-PHF19 (ARP50354_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PHF19
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Yeast: 92%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET
Concentration0.5 mg/ml
Blocking PeptideFor anti-PHF19 (ARP50354_P050-FITC) antibody is Catalog # AAP50354 (Previous Catalog # AAPS26404)
ReferenceOh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Gene SymbolPHF19
Gene Full NamePHD finger protein 19
Alias SymbolsPCL3, MTF2L1, TDRD19B
NCBI Gene Id26147
Protein NamePHD finger protein 19
Description of TargetPHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Uniprot IDQ5T6S3-2
Protein Accession #NP_001009936
Nucleotide Accession #NM_001009936
Protein Size (# AA)207
Molecular Weight22kDa
Protein InteractionsSUZ12; EZH2; SUV39H2; KDM1A; SUV39H1; HIC1; PHF19; EED;