MAGEA11 Antibody - middle region : FITC

Katalog-Nummer ARP59877_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

MAGEA11 Antibody - middle region : FITC (ARP59877_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-MAGEA11 (ARP59877_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MAGEA11
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Zebrafish: 77%
Peptide SequenceSynthetic peptide located within the following region: FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAGEA11 (ARP59877_P050-FITC) antibody is Catalog # AAP59877 (Previous Catalog # AAPP46037)
Gene SymbolMAGEA11
Gene Full NameMelanoma antigen family A, 11
Alias SymbolsCT1.11, MAGE11, MAGE-11, MAGEA-11
NCBI Gene Id4110
Protein NameMelanoma-associated antigen 11
Description of TargetThis gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP43364
Protein Accession #NP_005357
Nucleotide Accession #NM_005366
Protein Size (# AA)429
Molecular Weight48kDa
Protein InteractionsPIN4; NOS3; NDUFB9; IL11; IL6ST; HOXB5; THEM5; ZCCHC12; CDC20B; C18orf54; ACMSD; SNX20; TMEM123; BEX2; PCBD2; CCDC14; CCDC146; RADIL; TRMT1; DOCK10; RBM23; WDYHV1; DNAJC10; DIEXF; PNKD; TXN2; CLUAP1; TCF25; USP20; ENOX2; BCL2L11; GNPDA1; JADE3; MTA1; TPM3