LMX1A Antibody - N-terminal region : HRP
Katalog-Nummer ARP32673_P050-HRP
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-LMX1A (ARP32673_P050-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LMX1A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: LDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-LMX1A (ARP32673_P050-HRP) antibody is Catalog # AAP32673 (Previous Catalog # AAPP03683) |
Reference | Gregory,S.G., (2006) Nature 441 (7091), 315-321 |
---|---|
Gene Symbol | LMX1A |
Gene Full Name | LIM homeobox transcription factor 1, alpha |
Alias Symbols | LMX1, DFNA7, LMX1.1 |
NCBI Gene Id | 4009 |
Protein Name | LIM homeobox transcription factor 1-alpha |
Description of Target | Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin.Insulin is produced exclusively by the beta cells in the islets of Langerhans in the pancreas. The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear genes that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. LMX1 is a homeodomain protein that binds an A/T-rich sequence in the insulin promoter and stimulates transcription of insulin (German et al., 1994 [PubMed 7698771]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-199 AL160058.8 14249-14447 c 200-2447 AK127724.1 362-2609 2448-3382 AL390730.12 9415-10349 c |
Uniprot ID | Q8TE12 |
Protein Accession # | NP_796372 |
Nucleotide Accession # | NM_177398 |
Protein Size (# AA) | 382 |
Molecular Weight | 43kDa |
Protein Interactions | LDB1; BMPR2; ISL1; LHX3; LMX1A; TCF3; |