GSTM2 Antibody - N-terminal region : FITC

Katalog-Nummer ARP41818_P050-FITC

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

GSTM2 Antibody - N-terminal region : FITC (ARP41818_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-GSTM2 (ARP41818_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GSTM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
Concentration0.5 mg/ml
Blocking PeptideFor anti-GSTM2 (ARP41818_P050-FITC) antibody is Catalog # AAP41818 (Previous Catalog # AAPP10866)
ReferenceHayek,T., (2006) Atherosclerosis 184 (2), 404-412
Gene SymbolGSTM2
Gene Full NameGlutathione S-transferase mu 2 (muscle)
Alias SymbolsGST4, GSTM, GTHMUS, GSTM2-2
NCBI Gene Id2946
Protein NameGlutathione S-transferase Mu 2
Description of TargetAt present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM2 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.
Uniprot IDP28161
Protein Accession #NP_000839
Nucleotide Accession #NM_000848
Protein Size (# AA)218
Molecular Weight26kDa
Protein InteractionsUBC; GSTM3; GSTM2; GSTM1;