Spink13 (NM_001109539) Rat Tagged ORF Clone

CAT#: RR203608

  • TrueORF®

Spink13 (Myc-DDK-tagged ORF) - Rat similar to Kazal type serine protease inhibitor 4 (LOC689570), (10 ug)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


Plasmid Map

Product Images

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Spink13
Synonyms Spink5l3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR203608 representing NM_001109539
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAAGAAGGGGCTGCTGGCCACACAGGATCATCTTCTCCCTCATACTTTTGACTTGGACACATGTTA
CTTTAGCAGCACTTATCAGATCACATACCTTTTCTAACTGGCCTAAGCCCCCATGCAAAATGTATTACCC
AATAGACCCTGATTATGAAGCAAACTGTCCAGATGTGATAGCGCTGGTTTGTGCTACCAATGGCTTGAAC
TACAAGAACGAGTGCTTCTTTTGCATTGATCGGTGGGAGTTTGGACCTCACATCGAGTTTGTCAAATATG
GAAAATGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR203608 representing NM_001109539
Red=Cloning site Green=Tags(s)

MTRRGCWPHRIIFSLILLTWTHVTLAALIRSHTFSNWPKPPCKMYYPIDPDYEANCPDVIALVCATNGLN
YKNECFFCIDRWEFGPHIEFVKYGKCE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001109539
ORF Size 291 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001109539.1, NP_001103009.1
RefSeq Size 653 bp
RefSeq ORF 294 bp
Locus ID 689570
UniProt ID D3ZVP0
Cytogenetics 18q12.1
MW 11.4 kDa
Gene Summary May be a serine protease inhibitor (By similarity). Essential for sperm maturation and fertility. Inhibits sperm acrosome reaction, protecting sperm from premature reaction.[UniProtKB/Swiss-Prot Function]

Other Versions