NADE (BEX3) (NM_014380) Human Tagged ORF Clone

CAT#: RC212255

NGFRAP1 (Myc-DDK-tagged)-Human nerve growth factor receptor (TNFRSF16) associated protein 1 (NGFRAP1), transcript variant 3

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


Plasmid Map

Product Images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NADE
Synonyms Bex; DXS6984E; HGR74; NADE; NGFRAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212255 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAATATTCACCAGGAAAACGAAGAGATGGAGCAGCCTATGCAGAATGGAGAGGAAGACCGCCCTT
TGGGAGGAGGTGAAGGCCACCAGCCTGCAGGAAATCGACGGGGACAGGCTCGCCGACTTGCCCCTAATTT
TCGATGGGCCATACCCAATAGGCAGATCAATGATGGGATGGGTGGAGATGGAGATGATATGGAAATATTC
ATGGAGGAGATGAGAGAAATCAGAAGAAAACTTAGGGAGCTGCAGTTGAGGAATTGTCTGCGTATCCTTA
TGGGGGAGCTCTCTAATCACCATGACCATCATGATGAATTTTGCCTTATGCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212255 protein sequence
Red=Cloning site Green=Tags(s)

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIF
MEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014380
ORF Size 333 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014380.3
RefSeq Size 984 bp
RefSeq ORF 336 bp
Locus ID 27018
UniProt ID Q00994
Cytogenetics Xq22.2
Domains BEX
Protein Families Druggable Genome
Protein Pathways Neurotrophin signaling pathway
MW 13 kDa
Gene Summary May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.[UniProtKB/Swiss-Prot Function]

Other Versions