ZNF791 Antibody - middle region : FITC
Cat# ARP39955_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ZNF791 Antibody - middle region : FITC (ARP39955_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZNF791 (ARP39955_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF791 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 82% |
| Peptide Sequence | Synthetic peptide located within the following region: CKECGKAFSLHSSFQRHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF791 (ARP39955_P050-FITC) antibody is Catalog # AAP39955 (Previous Catalog # AAPP10268) |
| Reference | Suzuki,Y., (2004) Genome Res. 14 (9), 1711-1718 |
|---|---|
| Gene Symbol | ZNF791 |
| Gene Full Name | Zinc finger protein 791 |
| Alias Symbols | FLJ90396, MGC126179, MGC126180 |
| NCBI Gene Id | 163049 |
| Protein Name | Zinc finger protein 791 |
| Description of Target | ZNF791 may be involved in transcriptional regulation. |
| Uniprot ID | Q3KP31 |
| Protein Accession # | NP_699189 |
| Nucleotide Accession # | NM_153358 |
| Protein Size (# AA) | 576 |
| Molecular Weight | 67kDa |
| Protein Interactions | UBC; |
