- More Files
- Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TFDP1.
Immunogen
TFDP1 (NP_009042.1, 112 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFDP1 is 0.3 ng/ml as a capture antibody.ELISA
- Gene Info — TFDP1
Entrez GeneID
7027GeneBank Accession#
NM_007111Protein Accession#
NP_009042.1Gene Name
TFDP1
Gene Alias
DP1, DRTF1, Dp-1
Gene Description
transcription factor Dp-1
Omim ID
189902Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X
Other Designations
DRTF1-polypeptide 1|E2F dimerization partner 1|E2F-related transcription factor|OTTHUMP00000018765
- Interactome
- Pathway
- Disease