STAG3 Antibody - middle region : FITC

Cat# ARP53683_P050-FITC

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

STAG3 Antibody - middle region : FITC (ARP53683_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-STAG3 (ARP53683_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human STAG3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS
Concentration0.5 mg/ml
Blocking PeptideFor anti-STAG3 (ARP53683_P050-FITC) antibody is Catalog # AAP53683 (Previous Catalog # AAPP30525)
Sample Type Confirmation

STAG3 is supported by BioGPS gene expression data to be expressed in 721_B

SubunitSA-3
ReferenceBarber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448
Gene SymbolSTAG3
Gene Full NameStromal antigen 3
Alias Symbols-
NCBI Gene Id10734
Protein NameCohesin subunit SA-3
Description of TargetSTAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I.
Uniprot IDQ9UJ98
Protein Accession #NP_036579
Nucleotide Accession #NM_012447
Protein Size (# AA)1225
Molecular Weight135kDa
Protein InteractionsSMC3; SMC1A;