STAG3 Antibody - middle region : FITC
Cat# ARP53683_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-STAG3 (ARP53683_P050-FITC) antibody |
---|
Predicted Species Reactivity | Human, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human STAG3 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 83% |
Peptide Sequence | Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-STAG3 (ARP53683_P050-FITC) antibody is Catalog # AAP53683 (Previous Catalog # AAPP30525) |
Sample Type Confirmation | STAG3 is supported by BioGPS gene expression data to be expressed in 721_B |
Subunit | SA-3 |
Reference | Barber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448 |
---|---|
Gene Symbol | STAG3 |
Gene Full Name | Stromal antigen 3 |
Alias Symbols | - |
NCBI Gene Id | 10734 |
Protein Name | Cohesin subunit SA-3 |
Description of Target | STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I. |
Uniprot ID | Q9UJ98 |
Protein Accession # | NP_036579 |
Nucleotide Accession # | NM_012447 |
Protein Size (# AA) | 1225 |
Molecular Weight | 135kDa |
Protein Interactions | SMC3; SMC1A; |