SND1 Antibody - N-terminal region : HRP
Cat# ARP32563_T100-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
SND1 Antibody - N-terminal region : HRP (ARP32563_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-SND1 (ARP32563_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SND1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SND1 (ARP32563_T100-HRP) antibody is Catalog # AAP32563 (Previous Catalog # AAPP03566) |
| Sample Type Confirmation | SND1 is supported by BioGPS gene expression data to be expressed in Raji |
| Reference | Yang,J., et al., (2002) EMBO J. 21 (18), 4950-4958 |
|---|---|
| Gene Symbol | SND1 |
| Gene Full Name | Staphylococcal nuclease and tudor domain containing 1 |
| Alias Symbols | p100, TDRD11, Tudor-SN |
| NCBI Gene Id | 27044 |
| Protein Name | Staphylococcal nuclease domain-containing protein 1 |
| Description of Target | SND1 was originally characterized as a transcriptional coactivator for Epstein-Barr virus nuclear antigen 2. It is a STAT6 TAD interacting protein containing staphylococcal nuclease (SN)-like domain and tudor domain. p100 . The interaction is mediated by the TAD domain of STAT6 and the SN-like domain of SND1. SND1 associates with the large subunit of RNA polymerase II and is mediating interaction between STAT6 and RNA polymerase II. It was identified as a novel coactivator for STAT6 and suggest its functions as a bridging factor between STAT6 and the basal transcription machinery |
| Uniprot ID | Q7KZF4 |
| Protein Accession # | NP_055205 |
| Nucleotide Accession # | NM_014390 |
| Protein Size (# AA) | 885 |
| Molecular Weight | 100kDa |
| Protein Interactions | HUWE1; RAPGEF2; UBC; SUMO2; MDM2; LIN28A; SHFM1; DDX3X; EIF3CL; RPL35; RPS27; RPS26; RPS16; RPS11; RPS9; RPS6; RPS3A; RPS2; RPL23A; HNRNPU; TARDBP; UBD; RNU4-1; RNU5A-1; RNU6-1; PRPF8; RNU2-1; RNU1-1; G3BP1; VCAM1; MAK; ITGA4; FN1; CSNK2A1; SSR3; SRSF3; R |
