Biotrend > SF3B1 Antibody - N-terminal region : Biotin
SF3B1 Antibody - N-terminal region : Biotin
Brand : Aviva Systems Biology
Request more information
Please log in to use this feature.
Datasheets/Manuals | Printable datasheet for anti-SF3B1 (ARP40249_T100-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SF3B1 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Peptide Sequence | Synthetic peptide located within the following region: MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SF3B1 (ARP40249_T100-Biotin) antibody is Catalog # AAP40249 (Previous Catalog # AAPS02808) |
Subunit | 1 |
Reference | Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135 |
---|---|
Gene Symbol | SF3B1 |
Gene Full Name | Splicing factor 3b, subunit 1, 155kDa |
Alias Symbols | MDS, PRP10, Hsh155, PRPF10, SAP155, SF3b155 |
NCBI Gene Id | 23451 |
Protein Name | Splicing factor 3B subunit 1 |
Description of Target | SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Uniprot ID | O75533 |
Protein Accession # | NP_036565 |
Nucleotide Accession # | NM_012433 |
Protein Size (# AA) | 1304 |
Molecular Weight | 143kDa |
Protein Interactions | SART3; SUMO2; SUMO3; MDM2; STAU1; UBC; LGR4; WWOX; RPA3; RPA2; RPA1; ERG; EED; RNF2; EZH2; SUZ12; APBB1; PRPF40A; WBP4; TCERG1; FBXO6; RBM17; SNIP1; SF3B6; WHSC1; RPS2; RPL23A; RPL18A; RPL10; RPL3; PLRG1; SMAD9; SMAD5; SMAD1; IL7R; FN1; ESR1; CSNK2A1; EIF |
- SF3B1 Antibody - N-terminal region (ARP40733_T100)Catalog #: ARP40733_T100Species Tested: HumanApplication: WB, IHCFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- SF3B1 Antibody - N-terminal region (ARP40732_P050)Catalog #: ARP40732_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- SF3B1 Antibody - N-terminal region (ARP40249_T100)Catalog #: ARP40249_T100Species Tested: HumanApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- SF3B1 Antibody - middle region (ARP40248_T100)Catalog #: ARP40248_T100Species Tested: HumanApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.