- More Files
- Specification
Product Description
Human NOS2A partial ORF ( NP_000616, 685 a.a. - 794 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (72); Rat (71)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — NOS2
Entrez GeneID
4843GeneBank Accession#
NM_000625Protein Accession#
NP_000616Gene Name
NOS2
Gene Alias
HEP-NOS, INOS, NOS, NOS2A
Gene Description
nitric oxide synthase 2, inducible
Gene Ontology
HyperlinkGene Summary
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
NOS, type II|nitric oxide synthase 2A|nitric oxide synthase 2A (inducible, hepatocytes)|nitric oxide synthase, macrophage
- Interactome
- Pathway
- Disease
- Acute Disease
- Adenocarcinoma
- Albuminuria
- Alzheimer disease
- Anemia
- Angina
- Angina Pectoris
- Arthritis
- Asthma
+ View More Disease