- Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant MTAP.
Immunogen
MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
MTAP monoclonal antibody (M01), clone 2G4 Western Blot analysis of MTAP expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
MTAP monoclonal antibody (M01), clone 2G4. Western Blot analysis of MTAP expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
MTAP monoclonal antibody (M01), clone 2G4. Western Blot analysis of MTAP expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
MTAP monoclonal antibody (M01), clone 2G4. Western Blot analysis of MTAP expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MTAP is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10 ug/ml] - Gene Info — MTAP
Entrez GeneID
4507GeneBank Accession#
BC018625Protein Accession#
AAH18625Gene Name
MTAP
Gene Alias
MSAP, c86fus
Gene Description
methylthioadenosine phosphorylase
Omim ID
156540Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine. The encoded enzyme is deficient in many cancers because this gene and the tumor suppressor p16 gene are co-deleted. Multiple alternatively spliced transcript variants have been described for this gene, but their full-length natures remain unknown. [provided by RefSeq
Other Designations
5'-methylthioadenosine phosphorylase|MeSAdo phosphorylase|OTTHUMP00000021152
- Interactomes
- Pathways
- Diseases
- Publication Reference
- Analysis of TERT mRNA Levels and Clinicopathological Features in Patients with Peritoneal Mesothelioma.
Antonio d'Amati, Gabriella Serio, Andrea Quaranta, Luigi Vimercati, Michelina De Giorgis, Loredana Lorusso, Mariella Errede, Vito Longo, Andrea Marzullo, Domenico Ribatti, Tiziana Annese.
Cancers 2025 Jan; 17(2):252.
Application:IHC, Human, Peritoneal mesothelioma tissue.
- Higher Uptake of Preoperative 11C-Methionine Positron Emission Tomography Related to Preoperative Seizure in Patients With Oligodendroglioma.
Madan Bajagain, Akihisa Sakamoto, Tomoko Takajo, Ryutaro Makino, Hiroyuki Uchida, Keisuke Masuda, Nayuta Higa, Hajime Yonezawa, Kazutaka Yatsushiro, Akihide Tanimoto, Ryosuke Hanaya.
Curēus 2025 Jan; 17(1):e76991.
Application:IHC, Human, Glioma sections.
- MTAP as an emerging biomarker in thoracic malignancies.
Magdalena M Brune, Spasenija Savic Prince, Tatjana Vlajnic, Obinna Chijioke, Luca Roma, David König, Lukas Bubendorf.
Lung cancer (Amsterdam, Netherlands) 2024 Nov; 197:107963.
Application:IHC-p, Human, Lung.
- MTAP and p16 IHC as Markers for CDKN2A/B Loss in Meningiomas.
Hanim I Ozkizilkaya, Anjali Vinocha, Antonio Dono, Oluwaseun Basit Ogunbona, Gokce A Toruner, Phyu P Aung, Carlos Kamiya Matsuoka, Yoshua Esquenazi, Franco DeMonte, Leomar Y Ballester.
Cancers 2024 Sep; 16(19):3299.
Application:IHC-p, Human, Meningiomas.
- Comparing loss of p16 and MTAP expression in detecting CDKN2A homozygous deletion in pleomorphic xanthoastrocytoma.
M Adelita Vizcaino., Caterina Giannini., Rachael A Vaubel., Aivi T Nguyen., Jorge A Trejo-Lopez., Aditya Raghunathan., Sarah M Jenkins., Robert B Jenkins., Cinthya J Zepeda Mendoza.
Journal of Neuropathology and Eexperimental Neurology 2024 Jul; 0:nlae076.
Application:IHC, Human, Formalin-fixed, paraffin-embedded (FFPE) tissue.
- Prevalence of S-methyl-5'-thioadenosine Phosphorylase (MTAP) Deficiency in Human Cancer A Tissue Microarray Study on 13,067 Tumors From 149 Different Tumor Types.
Natalia Gorbokon, Niklas Wößner, Maximilian Lennartz, Sebastian Dwertmann Rico, Simon Kind, Viktor Reiswich, Florian Viehweger, Florian Lutz, Christoph Fraune, Andreas M Luebke, Claudia Hube-Magg, Anne Menz, Ria Schlichter, Till Krech, Andrea Hinsch, Eike Burandt, Guido Sauter, Ronald Simon, Stefan Steurer, Andreas H Marx, Patrick Lebok, David Dum, Sarah Minner, Frank Jacobsen, Till S Clauditz, Thilo Hackert, Faik G Uzunoǧlu, Lukas Bubendorf, Christian Bernreuther, Martina Kluth.
Am J Surg Pathol. 2024 Aug 12. doi: 10.1097/PAS.0000000000002297. Online ahead of print. 2024 Aug; 0:0.
Application:IHC, Human, Breast cancer, liver cancer, neuroendocrine tumors, pancreas cancer, squamous cell carcinomas..
- Usefulness of synthetic MRI for differentiation of IDH-mutant diffuse gliomas and its comparison with the T2-FLAIR mismatch sign.
Shumpei Onishi, Fumiyuki Yamasaki, Yuji Akiyama, Daisuke Kawahara, Vishwa Jeet Amatya, Ushio Yonezawa, Akira Taguchi, Iori Ozono, Novita Ikbar Khairunnisa, Yukio Takeshima, Nobutaka Horie.
J Neurooncol. 2024 Aug 12. doi: 10.1007/s11060-024-04794-0. Online ahead of print. 2024 Aug; 0:0.
Application:IHC, Human, Astrocytoma.
- T2-FLAIR mismatch sign, an imaging biomarker for CDKN2A-intact in non-enhancing astrocytoma, IDH-mutant.
Shumpei Onishi, Masato Kojima, Fumiyuki Yamasaki, Vishwa Jeet Amatya, Ushio Yonezawa, Akira Taguchi, Iori Ozono, Yukari Go, Yukio Takeshima, Eiso Hiyama, Nobutaka Horie.
Neurosurg Rev. 2024 Aug 9;47(1):412. doi: 10.1007/s10143-024-02632-5. 2024 Aug; 47(1):412.
Application:IHC, Human, Astrocytoma.
- Concordance between CDKN2A homozygous deletion and MTAP immunohistochemical loss in fluoroedenite-induced pleural mesothelioma: An immunohistochemical and molecular study on a single-institution series.
Giuseppe Broggi, Michele Massimino, Maria Failla, Veronica Filetti, Venerando Rapisarda, Caterina Ledda, Claudia Lombardo, Carla Loreto, Paolo Vigneri, Rosario Caltabiano .
Pathology, research and practice 2024 Jul; 259:155350.
Application:IHC-P, Human, Pleural mesothelioma.
- Ganglioglioma with anaplastic/high-grade transformation: Histopathologic, molecular, and epigenetic characterization of 3 cases.
M Adelita Vizcaino, Caterina Giannini, Daniel Lalich, Ali Nael, Robert B Jenkins, Quynh Tran, Brent A Orr, Zied Abdullaev, Kenneth Aldape, Rachael A Vaubel.
J Neuropathol Exp Neurol. 2024 Jun; 83(6):416.
Application:IHC, Human, Gangliogliomas.
- Loss of MTAP expression by immunohistochemistry is a surrogate marker for homozygous 9p21.3 deletion in urothelial carcinoma.
Tatjana Vlajnic, Obinna Chijioke, Luca Roma, Spasenija Savic Prince, Tobias Zellweger, Cyrill A Rentsch, Lukas Bubendorf.
Mod Pathol. 2024 Jun; 37(6):100495.
Application:IHC, Human, Urothelial carcinoma.
- Molecular prognostication in grade 3 meningiomas and p16/MTAP immunohistochemistry for predicting CDKN2A/B status.
Kira Tosefsky, Karina Chornenka Martin, Alexander D Rebchuk, Justin Z Wang, Farshad Nassiri, Amy Lum, Gelareh Zadeh, Serge Makarenko, Stephen Yip.
Neuro-Oncology Advances 2024 Jan; 6(1):vdae002.
Application:IHC-P, Human, Brain.
- Nestin may be a candidate marker for differential diagnosis between small duct type and large duct type intrahepatic cholangiocarcinomas.
Motoko Sasaki, Yasunori Sato, Yasuni Nakanuma.
Pathology, Research and Practice 2024 Jan; 253:155061.
Application:IHC, Human, Human liver.
- Sarcomatoid mesothelioma diagnosed in a patient with mesothelioma in situ: a case report on morphologic differences after 9-month interval with details analysis of cytology in early-stage mesothelioma.
Miho Yoshida, Naoe Jimbo, Ryuko Tsukamoto, Tomoo Itoh, Kunimitsu Kawahara, Suguru Mitsui, Yugo Tanaka, Yoshimasa Maniwa.
Diagnostic Pathology 2023 Nov; 18(1):126.
Application:IHC, Human, Pleural biopsy mesothelial cells.
- Evaluation of MTAP and p16 immunohistochemical deficiency as surrogate marker for CDKN2A/B homozygous deletion in gliomas.
Theoni Maragkou, Stefan Reinhard, Patric Jungo, Baptiste Pasquier, Maja Neuenschwander, Philippe Schucht, Erik Vassella, Ekkehard Hewer.
Pathology 2023 Jun; 55(4):466.
Application:IHC-P, Human, Human brain tumor.
- A clinicopathological analysis of supratentorial ependymoma, ZFTA fusion-positive: utility of immunohistochemical detection of CDKN2A alterations and characteristics of the immune microenvironment.
Naohito Hashimoto , Tomonari Suzuki , Keisuke Ishizawa , Sumihito Nobusawa , Hideaki Yokoo , Ryo Nishikawa , Masanori Yasuda , Atsushi Sasaki.
Brain Tumor Pathology 2023 Jul; 40(3):163.
Application:IHC-P, Human, Human brain.
- Usefulness of malignant pleural effusion for early cytological diagnosis of mesothelioma in situ: A case report.
Yuki Yabuuchi, Kenzo Hiroshima, Hisayuki Oshima, Jun Kanazawa, Kenji Hayashihara, Takayuki Nakagawa, Masaki Shimanouchi, Shingo Usui, Shuji Oh-ishi, Takefumi Saito, Nobuyuki Hizawa, Yuko Minami.
Oncology Letters 2022 Oct; 24(6):440.
Application:IHC, Human, Pleural biopsy.
- 34th European Congress of Pathology - Abstracts.
E. Olkhov-Mitsel, E. Slodkowska, M. Downes.
Virchows Archiv : an International Journal of Pathology 2022 Aug; 1:364.
Application:H&E/Others, Human, Human muscle invasive carcinomas.
- Seborrheic Keratosis With Malignant Transformation (Invasive or Noninvasive Squamous Cell Carcinoma Arising in Seborrheic Keratosis): A Clinicopathologic and Immunohistochemical Study of 11 Cases.
Keisuke Goto, Kohei Ogawa, Tsunekazu Hishima, Naoki Oishi, Ozumi Tomita, Takuji Tsuyuki, Takao Oda, Yoshifumi Iwahashi, Yutaka Inaba, Keiichiro Honma.
The American Journal of Dermatopathology 2022 Dec; 44(12):891.
Application:IF, Human, Human seborrheic keratosis.
- A Combination of MTAP and p16 Immunohistochemistry Can Substitute for CDKN2A Fluorescence In Situ Hybridization in Diagnosis and Prognosis of Pleural Mesotheliomas.
Luka Brcic, Nolwenn Le Stang, Florian Gallob, Daniel Pissaloux, Ruth Sequeiros, Sandrine Paindavoine, Jean Claude Pairon, Marie Karanian, Sanja Dacic, Nicolas Girard, Andrew Churg, Franck Tirode, Francoise Galateau-Salle.
Archives of Pathology & Laboratory Medicine 2023 Mar; 147(3):313.
Application:IHC, Human, epithelioid mesothelioma.
- Abemaciclib in patients with p16ink4A-deficient mesothelioma (MiST2): a single-arm, open-label, phase 2 trial.
Dean A Fennell, Amy King, Seid Mohammed, Alastair Greystoke, Sarah Anthony, Charlotte Poile, Nada Nusrat, Molly Scotland, Vina Bhundia, Amy Branson, Cassandra Brookes, Liz Darlison, Alan G Dawson, Aarti Gaba, Margaret Hutka, Bruno Morgan, Amrita Bajaj, Cathy Richards, Peter Wells-Jordan, Anne Thomas, MiST2 study group.
THE LANCET Oncology 2022 Mar; 23(3):374.
Application:IHC-P, Human, human mesothelioma.
- Sarcomatoid mesothelioma originating from mesothelioma in situ: are methylthioadenosine phosphorylase loss and CDKN2A homozygous deletion poor prognostic factors for preinvasive mesothelioma?
Megumi Nishikubo, Naoe Jimbo, Yugo Tanaka, Motoko Tachihara, Tomoo Itoh, Yoshimasa Maniwa.
Virchows Archiv : an International Journal of Pathology 2022 Aug; 481(2):307.
Application:IHC, Human, Human mesothelioma.
- Correlation of MTAP Immunohistochemistry With CDKN2A Status Assessed by Fluorescence In Situ Hybridization and Clinicopathological Features in CNS WHO Grade 2 and 3 Meningiomas: A Single Center Cohort Study.
Shoh Sasaki, Maiko Takeda, Takanori Hirose, Tomomi Fujii, Hiroe Itami, Tomoko Uchiyama, Kohei Morita, Ryosuke Matsuda, Shuichi Yamada, Ichiro Nakagawa, Chiho Ohbayashi.
Journal of Neuropathology and Eexperimental Neurology 2022 Jan; 81(2):117.
Application:IHC-P, Human, Human meningiomas.
- Loss of Methylthioadenosine Phosphorylase by Immunohistochemistry Is Common in Pulmonary Sarcomatoid Carcinoma and Sarcomatoid Mesothelioma.
Simone Terra, Anja C Roden, Eunhee S Yi, Marie Christine Aubry, Jennifer M Boland.
American Journal of Clinical Pathology 2022 Jan; 157(1):33.
Application:IHC, Human, Human sarcomatoid carcinoma, Human sarcomatoid mesothelioma.
- Malignant pleural mesothelioma with heterologous elements.
Toshiaki Kawa, Reishi Seki, Kuniharu Miyajima, Hiroshi Nakashima, Takayuki Takeda, Tomoyuki Murakami, Keisuke Aoe, Kazunori Okabe,Keiichi Homma, Yoshitane Tsukamoto, Koichi Sunada, Yasuhiro Terasaki, Maki Iida, Hideki Orikasa, Kenzo Hiroshima.
Journal of Clinical Pathology 2021 Aug; [Epub].
Application:IHC-P, Human, Human mesothelioma.
- CD146 immunohistochemical staining for the separation of benign from malignant mesothelial proliferations.
Taylor Salisbury, Andrew Churg.
Virchows Archiv : an International Journal of Pathology 2021 Nov; 479(5):1047.
Application:IHC, Human, Human mesothelioma, Human tissue microarray.
- Fluorescence in situ hybridization detection of chromosome 22 monosomy in pleural effusion cytology for the diagnosis of mesothelioma.
Yoshiaki Kinoshita, Makoto Hamasaki, Shinji Matsumoto, Masayo Yoshimura, Ayuko Sato, Tohru Tsujimura, Toshiaki Kamei, Kunimitsu Kawahara, Akinori Iwasaki, Kazuki Nabeshima.
Cancer Cytopathology 2021 Jul; 129(7):526.
Application:IHC-P, Human, Human malignant pleural mesothelioma, Human reactive mesothelial cells.
- Abstracts : 32 nd Congress of the ESP and XXXIII International Congress of the IAP.
No authors listed.
Virchows Archiv : an International Journal of Pathology 2020 Dec; 477(Suppl 1):1.
Application:IHC-Fr, IHC-P, Human, Human malignant pleural mesothelioma.
- Utility of methylthioadenosine phosphorylase immunohistochemical deficiency as a surrogate for CDKN2A homozygous deletion in the assessment of adult-type infiltrating astrocytoma.
Kaishi Satomi, Makoto Ohno, Yuko Matsushita, Masamichi Takahashi, Yasuji Miyakita, Yoshitaka Narita, Koichi Ichimura, Akihiko Yoshida.
Modern Pathology 2021 Apr; 34(4):688.
Application:IHC-P, Human, Human adult-type infiltrating astrocytoma, Human tissue microarray.
- c-MET immunohistochemistry for differentiating malignant mesothelioma from benign mesothelial proliferations.
He Zhen Ren, Simon Cheung, Andrew Churg.
Human Pathology 2020 Nov; 105:31.
Application:IHC, Human, Human epithelioid malignant mesotheliomas, Human sarcomatoid/desmoplastic mesotheliomas.
- Genomic-based Ancillary Assays Offer Improved Diagnostic Yield of Effusion Cytology With Potential Challenges in Malignant Pleural Mesothelioma.
Yoshiaki Kinoshita, Makoto Hamasaki, Shinji Matsumoto, Masayo Yoshimura, Ayuko Sato, Tohru Tsujimura, Toshiaki Kamei, Kunimitsu Kawahara, Kazuki Nabeshima.
Pathology International 2020 Sep; 70(9):671.
Application:ICC, IHC-P, Human, Human mesothelioma.
- Usefulness of methylthioadenosine phosphorylase and BRCA-associated protein 1 immunohistochemistry in the diagnosis of malignant mesothelioma in effusion cytology specimens.
Berg KB, Churg AM, Cheung S, Dacic S.
Cancer Cytopathology 2020 Feb; 128(2):126.
Application:IHC-P, Human, Malignant mesothelioma.
- Malignant mesothelioma in situ diagnosed by methylthioadenosine phosphorylase loss and homozygous deletion of CDKN2A: a case report.
Minami K, Jimbo N, Tanaka Y, Hokka D, Miyamoto Y, Itoh T, Maniwa Y.
Virchows Archiv : an International Journal of Pathology 2020 Mar; 476(3):469.
Application:IHC, Human, Human pleural biopsy.
- Detection of Anaplastic Lymphoma Kinase-Rearranged Mesothelioma Cells in Ascites by Companion Diagnostics.
Konishi M, Kanyama T, Maeno K, Miyagawa C, Minamiguchi S, Katsushima H, Shimada T.
Acta Cytologica 2019 Oct; 64(4):378.
Application:IHC-P, Human, Human lymphoma.
- Fluorescence in situ hybridization (FISH) provides estimates of minute and interstitial BAP1, CDKN2A, and NF2 gene deletions in peritoneal mesothelioma.
Brich S, Bozzi F, Perrone F, Tamborini E, Cabras AD, Deraco M, Stacchiotti S, Dagrada GP, Pilotti S.
Modern Pathology 2019 Sep; [Epub].
Application:IHC-P, Human, Peritoneal mesothelioma.
- Malignant mesothelioma in situ: morphologic features and clinical outcome.
Churg A, Galateau-Salle F, Roden AC, Attanoos R, von der Thusen JH, Tsao MS, Chang N, De Perrot M, Dacic S.
Modern Pathology 2019 Aug; [Epub].
Application:IHC, Human, Malignant mesothelioma.
- Hemizygous loss of NF2 detected by fluorescence in situ hybridization is useful for the diagnosis of malignant pleural mesothelioma.
Kinoshita Y, Hamasaki M, Yoshimura M, Matsumoto S, Iwasaki A, Nabeshima K.
Modern Pathology 2019 Jun; [Epub].
Application:IHC-P, Human, Human malignant pleural mesothelioma.
- MTAP immunohistochemistry is an accurate and reproducible surrogate for CDKN2A fluorescence in situ hybridization in diagnosis of malignant pleural mesothelioma.
Chapel DB, Schulte JJ, Berg K, Churg A, Dacic S, Fitzpatrick C, Galateau-Salle F, Hiroshima K, Krausz T, Le Stang N, McGregor S, Nabeshima K, Husain AN.
Modern Pathology 2019 Jun; [Epub].
Application:IHC, Human, Human pleural epithelioid malignant mesothelioma.
- Utility of Methylthioadenosine Phosphorylase Compared With BAP1 Immunohistochemistry, and CDKN2A and NF2 Fluorescence In Situ Hybridization in Separating Reactive Mesothelial Proliferations From Epithelioid Malignant Mesotheliomas.
Berg KB, Dacic S, Miller C, Cheung S, Churg A.
Archives of Pathology & Laboratory Medicine 2018 Dec; 142(12):1549.
Application:IHC-P, Human, Epithelioid malignant mesothelioma.
- Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression.
Rose AE, Poliseno L, Wang J, Clark M, Pearlman A, Wang G, Vega Y Saenz de Miera EC, Medicherla R, Christos PJ, Shapiro RL, Pavlick AC, Darvishian F, Zavadil J, Polsky D, Hernando E, Ostrer H, Osman I.
Cancer Research 2011 Apr; 71(7):2561.
Application:IHC, WB, Human, Primary melanoma cell lines, WM1552c cells.
- Analysis of TERT mRNA Levels and Clinicopathological Features in Patients with Peritoneal Mesothelioma.
MTAP monoclonal antibody (M01), clone 2G4
Cat# H00004507-M01
Size : 100ug
Brand : Abnova
Images