MDS1 Antibody - N-terminal region : FITC
Cat# ARP38536_T100-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
MDS1 Antibody - N-terminal region : FITC (ARP38536_T100-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-MDS1 (ARP38536_T100-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MDS1 |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Mouse: 93%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MDS1 (ARP38536_T100-FITC) antibody is Catalog # AAP38536 (Previous Catalog # AAPP20727) |
| Reference | Fears,S., et al., (1996) Proc. Natl. Acad. Sci. U.S.A. 93 (4), 1642-1647 |
|---|---|
| Gene Symbol | MDS1 |
| Gene Full Name | Myelodysplasia syndrome 1 |
| Alias Symbols | PRDM3, MDS1-EVI1 |
| NCBI Gene Id | 4197 |
| Protein Name | MDS1 and EVI1 complex locus protein MDS1 |
| Description of Target | MDS1 is located at 3q26 170-400 kb upstream (telomeric) of EVI1 in the chromosomal region in which some of the breakpoints 5' of EVI1 have been mapped. MDS1 has been identified as a single gene as well as a previously unreported exon(s) of EVI1. MDS1 exists in normal tissues both as a unique transcript and as a normal fusion transcript with EVI1, with an additional 188 codons at the 5' end of the previously reported EVI1 open reading frame. In cells with translocation t (3;21), additional fusion transcripts are AML1-MDS1 and AML1-MDS1-EVI1. EVI1 and MDS1 are involved in leukemia associated with chromosomal translocation breakpoints in the region between these genes. |
| Uniprot ID | Q13465 |
| Protein Accession # | NP_004982 |
| Nucleotide Accession # | NM_004991 |
| Protein Size (# AA) | 169 |
| Molecular Weight | 19kDa |
