Reagents and instruments for immunology, cell biology and molecular biology.
 
> Itga7 Antibody - N-terminal region : FITC

Itga7 Antibody - N-terminal region : FITC

Print Print
Please log in

Cat# ARP45241_P050-FITC

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

  • Titration: 1.0 ug/ml
    Positive Control: Rat LiverRat Liver
Datasheets/ManualsPrintable datasheet for anti-Itga7 (ARP45241_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Rat
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: CQQGTAATFSPDSHYLIFGAPGTYNWKGLLFVTNIDSSDPDQLVYKTLDP
Concentration0.5 mg/ml
Blocking PeptideFor anti-Itga7 (ARP45241_P050) antibody is Catalog # AAP45241 (Previous Catalog # AAPP26221)
Gene SymbolItga7
Gene Full NameIntegrin, alpha 7
Alias SymbolsMGC105724, Itga7
NCBI Gene Id81008
Protein NameIntegrin alpha-7
Description of TargetAs the alpha subunit of integrin alpha-7/beta-1; Itga7 functions as a laminin receptor.
Uniprot IDQ63258
Protein Accession #NP_110469
Nucleotide Accession #NM_030842
Protein Size (# AA)1135
Molecular Weight130kDa
Biological pathways
Name# of Products
Cell adhesion1115
Integrin-mediated signaling pathway441
Regulation of cell shape126
Skeletal muscle tissue development40
Biological process
Name# of Products
Blood vessel morphogenesis21
Cell adhesion446
Cell migration113
Integrin-mediated signaling pathway79
Regulation of cell shape99
Skeletal muscle tissue development53
Cellular components
Name# of Products
Cell surface369
Cytoplasm4549
Integral to membrane2793
Integrin complex36
Membrane2769
Protein function
Name# of Products
Cell adhesion molecule binding203
Integrin binding463
Laminin binding50
Protein binding12191
Protein heterodimerization activity1132
Receptor activity3624

  1. What is the species homology for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Itga7 Antibody - N-terminal region (ARP45241_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    This target may also be called "MGC105724, Itga7" in publications.

  5. What is the shipping cost for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "130kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Itga7 Antibody - N-terminal region (ARP45241_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ITGA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ITGA7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ITGA7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ITGA7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ITGA7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ITGA7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT