FOXP1 Antibody - N-terminal region : FITC
Cat# ARP32564_T100-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
FOXP1 Antibody - N-terminal region : FITC (ARP32564_T100-FITC)
| Datasheets/Manuals | Printable datasheet for anti-FOXP1 (ARP32564_T100-FITC) antibody |
|---|
| Publications | Jepsen, K., Gleiberman, A. S., Shi, C., Simon, D. I. & Rosenfeld, M. G. Cooperative regulation in development by SMRT and FOXP1. Genes Dev. 22, 740-5 (2008). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 18347093 Konstantoulas, C. J., Parmar, M. & Li, M. FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3. J. Neurochem. 113, 836-47 (2010). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 20175877 Tang, B. et al. Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease. Hum. Mol. Genet. 21, 3097-111 (2012). ChIP, Human, Mouse, Horse, Rabbit, Guinea pig, Rat, Bovine, Dog 22492998 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-FOXP1 (ARP32564_T100-FITC) antibody is Catalog # AAP32564 (Previous Catalog # AAPP03567) |
| Reference | Shi,C., et al., (2004) J. Clin. Invest. 114 (3), 408-418 |
|---|---|
| Gene Symbol | FOXP1 |
| Gene Full Name | Forkhead box P1 |
| Alias Symbols | MFH, QRF1, 12CC4, hFKH1B, HSPC215 |
| NCBI Gene Id | 27086 |
| Protein Name | Forkhead box protein P1 |
| Description of Target | FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). |
| Uniprot ID | Q9H334 |
| Protein Accession # | NP_116071 |
| Nucleotide Accession # | NM_032682 |
| Protein Size (# AA) | 677 |
| Molecular Weight | 75kDa |
| Protein Interactions | SUMO2; MYC; IL3RA; ELAVL1; NCOR2; GATAD2B; MTA1; FOXP1; FOXP4; FOXP2; CTBP1; |
