Specifications

Product Data
Applications	WB
Recommended Dilution	WB
Reactivities	Human
Host	Rabbit
Isotype	IgG
Clonality	Polyclonal
Immunogen	The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage	Store at -20°C as received.
Stability	Stable for 12 months from date of receipt.
Predicted Protein Size	73 kDa
Gene Name	eomesodermin
Database Link	NP_005433 Entrez Gene 8320 Human UniProt ID O95936
Background	EOMES is a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential
Synonyms	TBR2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors