- More Files
- Specification
Product Description
Human CYP2A6 partial ORF ( AAH28215, 395 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CYP2A6
Entrez GeneID
1548GeneBank Accession#
NG_000008Protein Accession#
AAH28215Gene Name
CYP2A6
Gene Alias
CPA6, CYP2A, CYP2A3, P450C2A, P450PB
Gene Description
cytochrome P450, family 2, subfamily A, polypeptide 6
Gene Ontology
HyperlinkGene Summary
This gene, CYP2A6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to hydroxylate coumarin, and also metabolizes nicotine, aflatoxin B1, nitrosamines, and some pharmaceuticals. Individuals with certain allelic variants are said to have a poor metabolizer phenotype, meaning they do not efficiently metabolize coumarin or nicotine. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. The gene was formerly referred to as CYP2A3; however, it has been renamed CYP2A6. [provided by RefSeq
Other Designations
coumarin 7-hydroxylase|cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 3|cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 6|flavoprotein-linked monooxygenase|xenobiotic monooxygenase
- Interactome
- Pathway
- Disease