CPA4

This gene is a member of the carboxypeptidase A/B subfamily, and it is located in a cluster with three other family members on chromosome 7. Carboxypeptidases are zinc-containing exopeptidases that catalyze the release of carboxy-terminal amino acids, and are synthesized as zymogens that are activated by proteolytic cleavage. This gene could be involved in the histone hyperacetylation pathway. It is imprinted and may be a strong candidate gene for prostate cancer aggressiveness. [provided by RefSeq, Jul 2008]

Suitable for use in Western Blot. Other applications not tested.

Western Blot: 1:500-1:2000
Optimal dilutions to be determined by the researcher.

SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGP

HepG2, A-549, 293T, mouse stomach, mouse brain, rat testis, rat lung, rat brain

May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Pab

IgG

rabbit

human

~1mg/ml

Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.

Purified by affinity chromatography.

Recombinant fusion protein containing a sequence corresponding to aa114-280 of human CPA4.

Recognizes human CPA4. Species Crossreactivity

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.