Arl8b (NM_026011) Mouse Tagged ORF Clone

CAT#: MR201737

  • TrueORF®

Arl8b (Myc-DDK-tagged) - Mouse ADP-ribosylation factor-like 8B (Arl8b)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


Plasmid Map


Interest in protein/lysate? Submit request here!

Product Images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Arl8b
Synonyms 2610313E07Rik; 3100002J04Rik; Arl10c; gie1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201737 representing NM_026011
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCGCTCATCTCCCGCCTGCTGGACTGGTTCCGTTCGCTCTTCTGGAAGGAGGAGATGGAACTGA
CGCTCGTGGGGCTGCAGTACTCCGGCAAGACCACCTTCGTCAATGTCATCGCGTCCGGTCAATTCAGTGA
AGATATGATACCCACAGTGGGCTTCAACATGAGGAAAGTAACTAAAGGCAACGTCACAATAAAGATCTGG
GACATAGGCGGACAGCCCCGGTTCCGGAGCATGTGGGAGCGGTACTGCCGAGGAGTCAATGCAATTGTTT
ACATGATAGATGCTGCAGATCGAGAAAAGATAGAAGCCTCTCGAAATGAACTGCATAATCTTCTAGATAA
ACCACAGTTACAAGGGATTCCAGTACTAGTACTTGGAAACAAGAGAGATCTTCCAAATGCCTTGGATGAG
AAACAGCTAATTGAGAAAATGAACCTGTCTGCTATTCAGGATAGAGAAATTTGCTGCTATTCAATTTCTT
GCAAAGAAAAGGATAATATAGATATCACACTTCAGTGGCTTATTCAACACTCAAAATCCCGGAGAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201737 representing NM_026011
Red=Cloning site Green=Tags(s)

MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW
DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE
KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_026011
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_026011.3, NP_080287.1
RefSeq Size 2928 bp
RefSeq ORF 561 bp
Locus ID 67166
UniProt ID Q9CQW2
Cytogenetics 6 E2
MW 22 kDa
Gene Summary Plays a role in lysosome motility (PubMed:30174114). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (PubMed:30174114). May play a role in chromosome segregation (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions