Anti-ADNP (Activity-Dependent neuroprotector Homeobox, ADNP1, KIAA0784) (HRP) Monoclonal Antibody

Cat# 243120-HRP-100ul

Size : 100ul

Brand : US Biological

Request more information

Contact local distributor :


Phone : +1 850 650 7790


243120-HRP ADNP (Activity-Dependent neuroprotector Homeobox, ADNP1, KIAA0784) (HRP)

Clone Type
Polyclonal
Host
mouse
Isotype
IgG2a,k
Grade
Purified
Applications
E IF WB
Accession #
NP_056154
Shipping Temp
Blue Ice
Storage Temp
-20°C

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq||Applications: |Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. |For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 2C5|Host: mouse|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).|Purity: Purified|Immunogen: ADNP (NP_056154, 1018aa-1102aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes ADNP.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
ADNP (NP_056154, 1018aa-1102aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified
Specificity
Recognizes ADNP.