ACAA2 Antibody - N-terminal region : Biotin
Cat# ARP48289_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ACAA2 Antibody - N-terminal region : Biotin (ARP48289_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ACAA2 (ARP48289_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 91%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ACAA2 (ARP48289_P050-Biotin) antibody is Catalog # AAP48289 (Previous Catalog # AAPY01658) |
| Reference | Aboulaich,N., Biochem. J. 383 (PT 2), 237-248 (2004) |
|---|---|
| Gene Symbol | ACAA2 |
| Gene Full Name | Acetyl-CoA acyltransferase 2 |
| Alias Symbols | DSAEC |
| NCBI Gene Id | 10449 |
| Protein Name | 3-ketoacyl-CoA thiolase, mitochondrial |
| Description of Target | ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. |
| Uniprot ID | P42765 |
| Protein Accession # | NP_006102 |
| Nucleotide Accession # | NM_006111 |
| Protein Size (# AA) | 397 |
| Molecular Weight | 42kDa |
| Protein Interactions | SUMO2; UBC; SGTA; P4HB; H2AFZ; TERT; TMEM65; RTN4; ZFR; TAX1BP3; TOMM40; SF3B4; VDAC2; VDAC1; TP53BP1; TIAL1; VAMP2; PFN1; PRDX1; APP; ACO2; ACAT1; SCP2; |
