Biotrend > PPA1 Antibody - N-terminal region : Biotin
PPA1 Antibody - N-terminal region : Biotin
Brand : Aviva Systems Biology
Request more information
Please log in to use this feature.
Size:100ul
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PPA1 (ARP48396_T100-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPA1 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 80%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PPA1 (ARP48396_T100-Biotin) antibody is Catalog # AAP48396 (Previous Catalog # AAPY01779) |
Reference | Maksimov,V.V., (2006) Genetika 42 (2), 274-277 |
---|---|
Gene Symbol | PPA1 |
Gene Full Name | Pyrophosphatase (inorganic) 1 |
Alias Symbols | PP, PP1, IOPPP, HEL-S-66p, SID6-8061 |
NCBI Gene Id | 5464 |
Protein Name | Inorganic pyrophosphatase |
Description of Target | PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q15181 |
Protein Accession # | NP_066952 |
Nucleotide Accession # | NM_021129 |
Protein Size (# AA) | 289 |
Molecular Weight | 33kDa |
Protein Interactions | SUMO2; FBXO6; NPM1; UBC; FN1; HSPD1; CLNS1A; CFL2; MTRNR2L1; SUMO4; Mapk13; HDAC6; HDAC3; HDAC1; AKT1; RB1; HSPB1; WIPI1; SETDB1; UNC119; TP53; |
- PPA1 Antibody - N-terminal region (ARP48396_T100)Catalog #: ARP48396_T100Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- PPA1 Antibody (OAGA00880)Catalog #: OAGA00880Conjugation: UnconjugatedApplication: ICC|IF|IHC-P|WBFormat: LiquidSize: 100UL
- PPA1 ELISA Kit (Human) (OKEH02477)Catalog #: OKEH02477Application: ELISA-SandwichKit Range: 15.6-1000pg/mLSensitivity: 7.2 pg/mLSize: 96W