Pcbd1 Antibody - C-terminal region : Biotin
Cat# ARP32448_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Pcbd1 (ARP32448_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 85% |
Peptide Sequence | Synthetic peptide located within the following region: VALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Pcbd1 (ARP32448_P050-Biotin) antibody is Catalog # AAP32448 (Previous Catalog # AAPP03444) |
Gene Symbol | Pcbd1 |
---|---|
Gene Full Name | Pterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1 |
Alias Symbols | Dco, Pcb, Pcd, Phs, Dcoh, Pcbd |
NCBI Gene Id | 13180 |
Protein Name | Pterin-4-alpha-carbinolamine dehydratase |
Description of Target | Pcbd1 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. It is a coactivator for HNF1A-dependent transcription. It regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. |
Uniprot ID | P61458 |
Protein Accession # | NP_079549 |
Nucleotide Accession # | NM_025273 |
Protein Size (# AA) | 104 |
Molecular Weight | 12kDa |
Protein Interactions | Pcbd2; Hnf1a; Zdhhc13; Pawr; Tle6; Chd4; Asb15; Brpf1; Cers2; Ercc8; Asb3; Zfp110; Hnf1b; Srebf1; Polr1a; Pcbd1; Zfp36l1; Bard1; |