Pcbd1 Antibody - C-terminal region : Biotin

Cat# ARP32448_P050-Biotin

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

Pcbd1 Antibody - C-terminal region : Biotin (ARP32448_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Pcbd1 (ARP32448_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: VALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS
Concentration0.5 mg/ml
Blocking PeptideFor anti-Pcbd1 (ARP32448_P050-Biotin) antibody is Catalog # AAP32448 (Previous Catalog # AAPP03444)
Gene SymbolPcbd1
Gene Full NamePterin 4 alpha carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 1
Alias SymbolsDco, Pcb, Pcd, Phs, Dcoh, Pcbd
NCBI Gene Id13180
Protein NamePterin-4-alpha-carbinolamine dehydratase
Description of TargetPcbd1 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. It is a coactivator for HNF1A-dependent transcription. It regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.
Uniprot IDP61458
Protein Accession #NP_079549
Nucleotide Accession #NM_025273
Protein Size (# AA)104
Molecular Weight12kDa
Protein InteractionsPcbd2; Hnf1a; Zdhhc13; Pawr; Tle6; Chd4; Asb15; Brpf1; Cers2; Ercc8; Asb3; Zfp110; Hnf1b; Srebf1; Polr1a; Pcbd1; Zfp36l1; Bard1;