Mymk (NM_025376) Mouse Tagged ORF Clone

CAT#: MR202529

  • TrueORF®

Tmem8c (Myc-DDK-tagged) - Mouse transmembrane protein 8C (Tmem8c), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


Plasmid Map


Interest in protein/lysate? Submit request here!

Product Images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Mymk
Synonyms 1110002H13Rik; AI131587; myomaker; Tmem8c
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202529 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACAGTTGTAGCCAAACTGCTCCTGCCTACCCTCAGCAGCCTGGCCTTCCTCCCGACAGTGAGCA
TCGCTACCAAGAGGCGTTTCTACATGGAGGCCATGGTCTACCTCTTCACCATGTTCTTTGTGGCGTTCTC
CCATGCCTGTGATGGGCCTGGTTTGTCTGTGCTGTGCTTCATGCGCCGTGACATTCTGGAGTACTTCAGC
ATCTATGGAACAGCCCTGAGCATGTGGGTCTCCCTGATGGCACTGGCCGACTTTGATGAACCCCAGAGAT
CGACCTTCACAATGCTTGGCGTCCTTACCATCGCTGTGCGGACTTTTCATGACCGCTGGGGTTACGGGGT
ATACTCCGGTCCCATAGGCACGGCCACCCTCATCATTGCTGTAAAGTGGCTGAAGAAGATGAAAGAGAAG
AAGGGCCTGTACCCCGACAAGAGCATCTACACCCAGCAGATAGGCCCCGGCCTGTGCTTTGGGGCCCTGG
CCCTGATGCTTCGATTCTTCTTTGAGGAATGGGATTACACCTACGTCCACAGCTTCTACCACTGTGCCCT
GGCCATGTCCTTTGTCCTGCTGCTGCCCAAGGTCAACAAGAAGGCTGGGAACGCAGGGGCCCCCGCCAAG
CTGACCTTCTCCACCCTCTGCTGCACTTGTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202529 protein sequence
Red=Cloning site Green=Tags(s)

MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPGLSVLCFMRRDILEYFS
IYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRTFHDRWGYGVYSGPIGTATLIIAVKWLKKMKEK
KGLYPDKSIYTQQIGPGLCFGALALMLRFFFEEWDYTYVHSFYHCALAMSFVLLLPKVNKKAGNAGAPAK
LTFSTLCCTCV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025376
ORF Size 666 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025376.3
RefSeq Size 1401 bp
RefSeq ORF 666 bp
Locus ID 66139
UniProt ID Q9D1N4
Cytogenetics 2 A3
MW 24.8 kDa
Gene Summary Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers (PubMed:23868259, PubMed:28386024, PubMed:28681861, PubMed:30197239). Actively participates in the membrane fusion reaction by mediating the mixing of cell membrane lipids (hemifusion) upstream of MYMX (PubMed:30197239). Acts independently of MYMX (PubMed:30197239). Involved in skeletal muscle regeneration in response to injury by mediating the fusion of satellite cells, a population of muscle stem cells, with injured myofibers (PubMed:25085416). Also involved in skeletal muscle hypertrophy, probably by mediating the fusion of satellite cells with myofibers (PubMed:28186492).[UniProtKB/Swiss-Prot Function]

Other Versions