ME1 Antibody - N-terminal region : Biotin
Cat# ARP32794_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
ME1 Antibody - N-terminal region : Biotin (ARP32794_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ME1 (ARP32794_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ME1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 100%; Rat: 100%; Sheep: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ME1 (ARP32794_P050-Biotin) antibody is Catalog # AAP32794 (Previous Catalog # AAPP03813) |
| Sample Type Confirmation | ME1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T |
| Reference | Hsieh,J.Y., (2006) J. Biol. Chem. 281 (32), 23237-23245 |
|---|---|
| Gene Symbol | ME1 |
| Gene Full Name | Malic enzyme 1, NADP(+)-dependent, cytosolic |
| Alias Symbols | MES, HUMNDME |
| NCBI Gene Id | 4199 |
| Protein Name | NADP-dependent malic enzyme |
| Description of Target | ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P48163 |
| Protein Accession # | NP_002386 |
| Nucleotide Accession # | NM_002395 |
| Protein Size (# AA) | 572 |
| Molecular Weight | 64kDa |
| Protein Interactions | UBC; VTA1; RPUSD2; GORASP2; BOP1; TOM1; NMI; CUL3; UGDH; TBCD; GTF2A1; GARS; CTTN; |
