HBP1 Antibody - middle region : Biotin
Cat# ARP32559_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HBP1 (ARP32559_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HBP1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HBP1 (ARP32559_P050-Biotin) antibody is Catalog # AAP32559 (Previous Catalog # AAPP03562) |
Reference | Paulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145 |
---|---|
Gene Symbol | HBP1 |
Gene Full Name | HMG-box transcription factor 1 |
Alias Symbols | FLJ16340 |
NCBI Gene Id | 26959 |
Protein Name | HMG box-containing protein 1 |
Description of Target | HBP1 is a transcriptional repressor that binds to the promoter region of target genes. It plays a role in the regulation of the cell cycle and of the Wnt pathway. HBP1 binds preferentially to the sequence 5'-TTCATTCATTCA-3'.The protein also disrupts the interaction between DNA and TCF4. |
Uniprot ID | O60381 |
Protein Accession # | NP_036389 |
Nucleotide Accession # | NM_012257 |
Protein Size (# AA) | 514 |
Molecular Weight | 58kDa |
Protein Interactions | FBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1; |