HBP1 Antibody - middle region : Biotin

Cat# ARP32559_P050-Biotin

Size : 100ul

Brand : Aviva Systems Biology

Request more information

Contact local distributor :


Phone : +1 850 650 7790

HBP1 Antibody - middle region : Biotin (ARP32559_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-HBP1 (ARP32559_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HBP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA
Concentration0.5 mg/ml
Blocking PeptideFor anti-HBP1 (ARP32559_P050-Biotin) antibody is Catalog # AAP32559 (Previous Catalog # AAPP03562)
ReferencePaulson,K.E., (2007) Cancer Res. 67 (13), 6136-6145
Gene SymbolHBP1
Gene Full NameHMG-box transcription factor 1
Alias SymbolsFLJ16340
NCBI Gene Id26959
Protein NameHMG box-containing protein 1
Description of TargetHBP1 is a transcriptional repressor that binds to the promoter region of target genes. It plays a role in the regulation of the cell cycle and of the Wnt pathway. HBP1 binds preferentially to the sequence 5'-TTCATTCATTCA-3'.The protein also disrupts the interaction between DNA and TCF4.
Uniprot IDO60381
Protein Accession #NP_036389
Nucleotide Accession #NM_012257
Protein Size (# AA)514
Molecular Weight58kDa
Protein InteractionsFBXW11; UBC; TMEM37; SMAD1; ZNF212; KIAA1279; EWSR1; CD2AP; EP300; CREBBP; MYC; ANKRD2; SIN3A; SAP30; TCF4; HDAC1; RBL2; RB1;