Glucagon Like Peptide-2, Human (GLP-2)

Cat# 298174-100ug

Size : 100ug

Brand : US Biological

Request more information

Contact local distributor :


Phone : +1 850 650 7790


298174 Glucagon Like Peptide-2, Human (GLP-2)

Clone Type
Polyclonal
Swiss Prot
P01275
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.||Source:|Synthetic human Glucagon Like Peptide-2 ||AA Sequence:|HADGSFSDEMNTILDNLAARDFINWLIQTKITD||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Synthetic|Purity: ≥90% (HPLC)|Form: Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
Purity
≥90% (HPLC)