Biotrend > GJB2 Antibody - middle region : Biotin
GJB2 Antibody - middle region : Biotin
Brand : Aviva Systems Biology
Request more information
Please log in to use this feature.
Datasheets/Manuals | Printable datasheet for anti-GJB2 (ARP36608_T100-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GJB2 |
Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86% |
Peptide Sequence | Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-GJB2 (ARP36608_T100-Biotin) antibody is Catalog # AAP36608 (Previous Catalog # AAPP07847) |
Reference | Hromas,R., et al., (2004) Neurosci. Res. 50 (1), 125-128 |
---|---|
Gene Symbol | GJB2 |
Gene Full Name | Gap junction protein, beta 2, 26kDa |
Alias Symbols | HID, KID, PPK, BAPS, CX26, DFNA3, DFNB1, NSRD1, DFNA3A, DFNB1A |
NCBI Gene Id | 2706 |
Protein Name | Gap junction beta-2 protein |
Description of Target | Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 (MIM 121014) is designated alpha-1 gap junction protein, whereas CX32 (GJB1; MIM 304040) and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43. |
Uniprot ID | P29033 |
Protein Accession # | NP_003995 |
Nucleotide Accession # | NM_004004 |
Protein Size (# AA) | 226 |
Molecular Weight | 25kDa |
Protein Interactions | CD14; CNST; FBXO2; SKP1; UBC; GJB6; CAV1; GJB1; |
- GJB2 Antibody - middle region (ARP36608_T100)Catalog #: ARP36608_T100Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Goat Anti-GJB2 / Connexin 26 Antibody (OAEB01163)Catalog #: OAEB01163Application: ELISA|FC|WBFormat: Supplied at 0.5 mg/ml in Tris saline, 0.02% sodium azide, pH7.3 with 0.5% bovine serum albumin.Size: 100UG
- GJB2 Antibody (OABB00122)Catalog #: OABB00122Clone: PolyclonalSpecies Tested: Human, RatApplication: WBFormat: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.Size: 100UG
- GJB2 Antibody - C-terminal region (OAAB11368)Catalog #: OAAB11368Application: IHC-P,WBFormat: Liquid. PBS with 0.09% (W/V) sodium azide.Size: 400UL