EEF1A1 Antibody - C-terminal region : HRP
Cat# ARP48166_T100-HRP
Size : 100ul
Brand : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-EEF1A1 (ARP48166_T100-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EEF1A1 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EEF1A1 (ARP48166_T100-HRP) antibody is Catalog # AAP48166 (Previous Catalog # AAPP28675) |
Sample Type Confirmation | EEF1A1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Reference | Zhang,Y., (2008) Biochem. Biophys. Res. Commun. 369 (4), 1057-1060 |
---|---|
Gene Symbol | EEF1A1 |
Gene Full Name | Eukaryotic translation elongation factor 1 alpha 1 |
Alias Symbols | CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-Tu, LENG7, eEF1A-1, GRAF-1EF |
NCBI Gene Id | 1915 |
Protein Name | Elongation factor 1-alpha 1 |
Description of Target | EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P68104 |
Protein Accession # | NP_001393 |
Nucleotide Accession # | NM_001402 |
Protein Size (# AA) | 462 |
Molecular Weight | 50kDa |
Protein Interactions | GPX7; FUS; UBC; ISG15; SUMO3; CEP250; TUBGCP2; TUBG1; TP53; AURKA; SUMO2; STAU1; ALPL; LGR4; MDM2; RPA3; RPA2; RPA1; SHFM1; rev; PPP1CB; PFKP; GAPDH; PARK2; TRAP1; FBXO6; EGFR; ADRB2; RAD52; NPM1; CD81; BBS4; BBS2; BBS1; AICDA; STAT6; RBBP8; FN1; CDC25A; |