ALKBH3 Rabbit Polyclonal Antibody
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ALKBH3 Antibody: synthetic peptide directed towards the middle region of human ALKBH3. Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 33 kDa |
Gene Name | alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase |
Database Link | |
Background | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]). [supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1519 AB042029.1 2-1520 |
Synonyms | ABH3; DEPC-1; DEPC1; PCA1 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
|
SDS |
Resources
Antibody Resources |
|