TIMP2 (Tissue Inhibitor of Metalloproteinases 2, TIMP-2, Metalloproteinase Inhibitor 2, CSC-21K, DDC8) (APC)

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Pab

IgG

rabbit

human

As Reported

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

Purified by Protein A affinity chromatography.

Full length human TIMP2, aa1-220 (NP_003246.1).

Recognizes human TIMP2. Species Crossreactivity

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.