ARP36281_P050-HRP | ZNF30 Antibody - middle region : HRP Biotrend

Datasheets/Manuals	Printable datasheet for anti-ZNF30 (ARP36281_P050-HRP) antibody

Product Info
Predicted Species Reactivity	Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product Format	Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality	Polyclonal
Host	Rabbit
Conjugation	HRP: Horseradish Peroxidase
Application	WB
Reconstitution and Storage	All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZNF30
Purification	Affinity Purified
Predicted Homology Based on Immunogen Sequence	Cow: 91%; Dog: 83%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 91%; Rabbit: 83%; Rat: 91%; Zebrafish: 86%
Peptide Sequence	Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI
Concentration	0.5 mg/ml
Blocking Peptide	For anti-ZNF30 (ARP36281_P050-HRP) antibody is Catalog # AAP36281 (Previous Catalog # AAPP07640)

Reference	Gerhard,D.S., (1990) New Biol. 2 (4), 363-374
Gene Symbol	ZNF30
Gene Full Name	Zinc finger protein 30
Alias Symbols	KOX28
NCBI Gene Id	90075
Protein Name	Zinc finger protein 30
Description of Target	The exact function of ZNF30 is not known.
Uniprot ID	P17039
Protein Accession #	NP_919306
Nucleotide Accession #	NM_194325
Protein Size (# AA)	623
Molecular Weight	71kDa
Protein Interactions	CLK2;

ZNF30 Antibody - middle region : HRP