ZNF141 Antibody - middle region : FITC
Katalog-Nummer ARP38338_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
ZNF141 Antibody - middle region : FITC (ARP38338_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ZNF141 (ARP38338_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF141 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ZNF141 (ARP38338_P050-FITC) antibody is Catalog # AAP38338 (Previous Catalog # AAPP20525) |
| Reference | Varrault,A., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (15), 8835-8840 |
|---|---|
| Gene Symbol | ZNF141 |
| Gene Full Name | Zinc finger protein 141 |
| Alias Symbols | D4S90, pHZ-44 |
| NCBI Gene Id | 7700 |
| Protein Name | Zinc finger protein 141 |
| Description of Target | Zinc finger encoding genes would be good candidates for being involved in the multiple developmental defects associated with chromosomal aneusomy--because of their role as transcriptional regulators, their abundance in the genome and their known association with specific developmental disorders. A zinc finger encoding cDNA (ZNF141) of the C2-H2/KRAB subfamily has been mapped to the 4p- (Wolf-Hirschhorn) syndrome (WHS) chromosome region. ZNF141 was expressed ubiquitously at low levels in the analysed tissue. The identification of a candidate gene for a chromosomal aneusomy syndrome belonging to a class of evolutionary conserved genes will provide options for studying its normal and abnormal expression during mammalian embryogenesis. |
| Uniprot ID | Q15928 |
| Protein Accession # | NP_003432 |
| Nucleotide Accession # | NM_003441 |
| Protein Size (# AA) | 474 |
| Molecular Weight | 55kDa |
| Protein Interactions | UBC; SUMO1; SUMO3; |