WNT5A antibody - middle region

Katalog-Nummer ARP32128_P050

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

WNT5A Antibody - middle region (ARP32128_P050)

Datasheets/ManualsPrintable datasheet for anti-WNT5A (ARP32128_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Additional InformationIHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WNT5A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80%
Peptide SequenceSynthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
Concentration0.5 mg/ml
Blocking PeptideFor anti-WNT5A (ARP32128_P050) antibody is Catalog # AAP32128 (Previous Catalog # AAPP23848)
Sample Type Confirmation

WNT5A is strongly supported by BioGPS gene expression data to be expressed in HeLa

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceWitze,E.S., (2008) Science 320 (5874), 365-369
Gene SymbolWNT5A
Gene Full NameWingless-type MMTV integration site family, member 5A
Alias SymbolshWNT5A
NCBI Gene Id7474
Protein NameProtein Wnt-5a
Description of TargetThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP41221
Protein Accession #NP_003383
Nucleotide Accession #NM_003392
Protein Size (# AA)380
Molecular Weight42 kDa
Protein InteractionsUBC; LRP6; FZD2; FZD1; ROR2; FZD5;