WNT5A antibody - middle region
Katalog-Nummer ARP32128_P050
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
WNT5A Antibody - middle region (ARP32128_P050)
| Datasheets/Manuals | Printable datasheet for anti-WNT5A (ARP32128_P050) antibody |
|---|
| Tested Species Reactivity | Human | ||
|---|---|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish | ||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
| Clonality | Polyclonal | ||
| Host | Rabbit | ||
| Application | WB, IHC | ||
| Additional Information | IHC Information: Human Brain, Cortex: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Colon, Myenteric Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE) | ||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT5A | ||
| Purification | Affinity Purified | ||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 80% | ||
| Peptide Sequence | Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT | ||
| Concentration | 0.5 mg/ml | ||
| Blocking Peptide | For anti-WNT5A (ARP32128_P050) antibody is Catalog # AAP32128 (Previous Catalog # AAPP23848) | ||
| Sample Type Confirmation | WNT5A is strongly supported by BioGPS gene expression data to be expressed in HeLa | ||
| Enhanced Validation |
|
| Reference | Witze,E.S., (2008) Science 320 (5874), 365-369 |
|---|---|
| Gene Symbol | WNT5A |
| Gene Full Name | Wingless-type MMTV integration site family, member 5A |
| Alias Symbols | hWNT5A |
| NCBI Gene Id | 7474 |
| Protein Name | Protein Wnt-5a |
| Description of Target | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5A is a member of the WNT protein family. It shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction.The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98%, 98% and 87% amino acid identity to the mouse, rat and the xenopus Wnt5A protein, respectively. The experiments performed in Xenopus laevis embryos identified that human frizzled-5 (hFz5) is the receptor for the Wnt5A ligand and the Wnt5A/hFz5 signaling mediates axis induction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P41221 |
| Protein Accession # | NP_003383 |
| Nucleotide Accession # | NM_003392 |
| Protein Size (# AA) | 380 |
| Molecular Weight | 42 kDa |
| Protein Interactions | UBC; LRP6; FZD2; FZD1; ROR2; FZD5; |
