TSHZ3 Antibody - middle region : FITC
Katalog-Nummer ARP32682_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
TSHZ3 Antibody - middle region : FITC (ARP32682_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-TSHZ3 (ARP32682_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TSHZ3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83% |
| Peptide Sequence | Synthetic peptide located within the following region: VARHYLFENTDQPIDLTKSKSKRAESSQAQSCTSPPQKHALCDIADMVKV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TSHZ3 (ARP32682_P050-FITC) antibody is Catalog # AAP32682 |
| Gene Symbol | TSHZ3 |
|---|---|
| Gene Full Name | teashirt zinc finger homeobox 3 |
| Alias Symbols | TSH3, ZNF537 |
| NCBI Gene Id | 57616 |
| Protein Name | teashirt homolog 3 |
| Uniprot ID | Q63HK5 |
| Protein Accession # | NP_065907.2 |
| Nucleotide Accession # | NM_020856.2 |
| Protein Size (# AA) | 384 |
| Molecular Weight | 42kDa |
