TRPM3 Antibody - N-terminal region : Biotin
Katalog-Nummer ARP36768_T100-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
TRPM3 Antibody - N-terminal region : Biotin (ARP36768_T100-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-TRPM3 (ARP36768_T100-Biotin) antibody |
|---|
| Publications | Takumida, M., Ishibashi, T., Hamamoto, T., Hirakawa, K. & Anniko, M. Expression of transient receptor potential channel melastin (TRPM) 1-8 and TRPA1 (ankyrin) in mouse inner ear. Acta Otolaryngol. 129, 1050-60 (2009). IHC, Human, Zebrafish, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Guinea pig 19065290 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM3 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TRPM3 (ARP36768_T100-Biotin) antibody is Catalog # AAP36768 (Previous Catalog # AAPP08368) |
| Reference | Grimm,C., et al., (2003) J. Biol. Chem. 278 (24), 21493-501 |
|---|---|
| Gene Symbol | TRPM3 |
| Gene Full Name | Transient receptor potential cation channel, subfamily M, member 3 |
| Alias Symbols | GON-2, MLSN2, LTRPC3 |
| NCBI Gene Id | 80036 |
| Protein Name | TRPM3 protein EMBL AAH94699.1 |
| Description of Target | The product of the TRPM3 gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by TRPM3 mediates calcium entry, and this entry is potentiated by calcium store depletion. |
| Uniprot ID | Q504Y1 |
| Protein Accession # | AAH94699 |
| Nucleotide Accession # | NM_001007470 |
| Protein Size (# AA) | 323 |
| Molecular Weight | 36kDa |
