TRIM23 Antibody - middle region : Biotin
Katalog-Nummer ARP32672_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
TRIM23 Antibody - middle region : Biotin (ARP32672_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-TRIM23 (ARP32672_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TRIM23 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: KHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TRIM23 (ARP32672_P050-Biotin) antibody is Catalog # AAP32672 (Previous Catalog # AAPP03682) |
| Reference | Vichi,A., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (6), 1945-1950 |
|---|---|
| Gene Symbol | TRIM23 |
| Gene Full Name | Tripartite motif containing 23 |
| Alias Symbols | ARD1, ARFD1, RNF46 |
| NCBI Gene Id | 373 |
| Protein Name | E3 ubiquitin-protein ligase TRIM23 |
| Description of Target | TRIM23 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. |
| Uniprot ID | P36406-3 |
| Protein Accession # | NP_150231 |
| Nucleotide Accession # | NM_033228 |
| Protein Size (# AA) | 546 |
| Molecular Weight | 61kDa |
| Protein Interactions | LGALS8; TNFAIP3; TMSB4X; SNRPB; SNAI1; SNAI2; SIAH1; PSMA1; PIK3R2; PHF1; LMO2; FAM90A1; KRT6A; KIFC3; HOXB5; COX5B; CDR2; BAG1; TRIM23; AQP1; SLC25A6; FAM208B; FAM193B; ZNF581; SPG21; MRPL4; ARHGEF3; POLL; NFU1; GPKOW; HSPB7; PPIL2; TRIM29; DMC1; USP20; |
