TNNT1 antibody - middle region
Katalog-Nummer ARP42120_P050
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
TNNT1 Antibody - middle region (ARP42120_P050)
| Datasheets/Manuals | Printable datasheet for anti-TNNT1 (ARP42120_P050) antibody |
|---|
| Tested Species Reactivity | Human, Mouse | ||||||
|---|---|---|---|---|---|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish | ||||||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
| Clonality | Polyclonal | ||||||
| Host | Rabbit | ||||||
| Application | WB | ||||||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TNNT1 | ||||||
| Purification | Affinity Purified | ||||||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85% | ||||||
| Peptide Sequence | Synthetic peptide located within the following region: WIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK | ||||||
| Concentration | 0.5 mg/ml | ||||||
| Blocking Peptide | For anti-TNNT1 (ARP42120_P050) antibody is Catalog # AAP42120 (Previous Catalog # AAPP24505) | ||||||
| Enhanced Validation |
|
| Reference | Witt,S.H., (2005) J. Mol. Biol. 350 (4), 713-722 |
|---|---|
| Gene Symbol | TNNT1 |
| Gene Full Name | Troponin T type 1 (skeletal, slow) |
| Alias Symbols | ANM, TNT, NEM5, STNT, TNTS |
| NCBI Gene Id | 7138 |
| Protein Name | Troponin T, slow skeletal muscle |
| Description of Target | TNNT1 is a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year.This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | P13805 |
| Protein Accession # | NP_003274 |
| Nucleotide Accession # | NM_003283 |
| Protein Size (# AA) | 278 |
| Molecular Weight | 33kDa |
| Protein Interactions | CCDC136; TFIP11; LDOC1; MORF4L1; TBPL1; TPM3; TPM1; TNNT1; NFE2L2; KRT40; UBC; PI4KA; SERPINA4; OSM; MARS; HSP90AB1; FYN; EEF1G; DDX5; CHD3; BLOC1S2; C2orf44; ZNF768; ZNF250; ZC3H15; NAGK; HMP19; TRA2A; TMEM98; ARMC8; OSBP2; ZKSCAN5; LARP1; NACAD; SNW1; S |
