- More Files
- Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TFF3.
Immunogen
TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (76)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFF3 is approximately 0.1ng/ml as a capture antibody.ELISA
- Gene Info — TFF3
Entrez GeneID
7033GeneBank Accession#
BC017859Protein Accession#
AAH17859.1Gene Name
TFF3
Gene Alias
HITF, ITF, TFI, hP1.B
Gene Description
trefoil factor 3 (intestinal)
Omim ID
600633Gene Ontology
HyperlinkGene Summary
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq
Other Designations
intestinal trefoil factor|secretory protein|trefoil factor 3|trefoil factor 3, HITF, human intestinal trefoil factor
- Interactome
- Disease
- Publication Reference
- Identification and use of the putative Bacteroides ovatus xylanase promoter for the inducible production of recombinant human proteins.
Hamady ZZ, Farrar MD, Whitehead TR, Holland KT, Lodge JP, Carding SR.
Microbiology 2008 Oct; 154(Pt 10):3165.
Application:EPair-Re, Human, Recombinant protein.
- Identification and use of the putative Bacteroides ovatus xylanase promoter for the inducible production of recombinant human proteins.