SRP54A Antibody - C-terminal region : Biotin

Katalog-Nummer ARP40457_P050-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

SRP54A Antibody - C-terminal region : Biotin (ARP40457_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SRP54A (ARP40457_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 83%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGL
Concentration0.5 mg/ml
Blocking PeptideFor anti-SRP54A (ARP40457_P050-Biotin) antibody is Catalog # AAP40457
Gene SymbolSRP54A
Gene Full Namesignal recognition particle 54A
Alias SymbolsSrp54
NCBI Gene Id116650
Protein Namesignal recognition particle 54 kDa protein
Description of Targetmay recognize signal sequences of secretory proteins and may retard them in the endoplasmic reticulum; may regulate synthesis of the secretory protein osteopontin [RGD, Feb 2006]
Uniprot IDQ6AYB5
Protein Accession #NP_446323
Nucleotide Accession #NM_053871
Protein Size (# AA)504
Molecular Weight55kDa