SRP54 Antibody - middle region : Biotin
Katalog-Nummer ARP40458_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
SRP54 Antibody - middle region : Biotin (ARP40458_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-SRP54 (ARP40458_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRP54 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SRP54 (ARP40458_P050-Biotin) antibody is Catalog # AAP40458 (Previous Catalog # AAPP22226) |
| Reference | Sakashita,E., (2004) Mol. Cell. Biol. 24 (3), 1174-1187 |
|---|---|
| Gene Symbol | SRP54 |
| Gene Full Name | Signal recognition particle 54kDa |
| Alias Symbols | SCN8 |
| NCBI Gene Id | 6729 |
| Protein Name | Signal recognition particle 54 kDa protein |
| Description of Target | SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein). |
| Uniprot ID | P61011 |
| Protein Accession # | NP_003127 |
| Nucleotide Accession # | NM_003136 |
| Protein Size (# AA) | 504 |
| Molecular Weight | 56kDa |
| Protein Interactions | UBC; TARBP2; rev; SOX2; RNPS1; GEMIN4; GEMIN5; DDX20; GEMIN2; SRP68; SRP14; SRP9; SMN1; SF3B6; SF3A1; XRCC4; TFAP4; PRKDC; RNF185; SRP54; SRP19; |
