SLC27A3 Antibody - middle region : Biotin
Katalog-Nummer ARP44038_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-SLC27A3 (ARP44038_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC27A3 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SLC27A3 (ARP44038_P050-Biotin) antibody is Catalog # AAP44038 (Previous Catalog # AAPP11779) |
Gene Symbol | SLC27A3 |
---|---|
Gene Full Name | Solute carrier family 27 (fatty acid transporter), member 3 |
Alias Symbols | FATP3, ACSVL3, VLCS-3 |
NCBI Gene Id | 11000 |
Protein Name | Long-chain fatty acid transport protein 3 |
Description of Target | SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity. |
Uniprot ID | Q5K4L6 |
Protein Accession # | NP_077306 |
Nucleotide Accession # | NM_024330 |
Protein Size (# AA) | 730 |
Molecular Weight | 79kDa |
Protein Interactions | UBC; RNF2; |