Slc25a27 Antibody - C-terminal region : Biotin
Katalog-Nummer ARP43880_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
Slc25a27 Antibody - C-terminal region : Biotin (ARP43880_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Slc25a27 (ARP43880_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85% |
| Peptide Sequence | Synthetic peptide located within the following region: EDNISTHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Slc25a27 (ARP43880_P050-Biotin) antibody is Catalog # AAP43880 (Previous Catalog # AAPP25417) |
| Gene Symbol | Slc25a27 |
|---|---|
| Gene Full Name | Solute carrier family 25, member 27 |
| Alias Symbols | Ucp, Ucp4, 3632410G24Rik, 9430092A03Rik, D530043E16Rik |
| NCBI Gene Id | 74011 |
| Protein Name | Protein Slc25a27 Ensembl ENSMUSP00000024705 |
| Description of Target | The function remains unknown. |
| Uniprot ID | Q9D6D0 |
| Protein Accession # | NP_082987 |
| Nucleotide Accession # | NM_028711 |
| Protein Size (# AA) | 322 |
| Molecular Weight | 36kDa |
