SLC25A11 Antibody - C-terminal region : Biotin
Katalog-Nummer ARP43850_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
SLC25A11 Antibody - C-terminal region : Biotin (ARP43850_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-SLC25A11 (ARP43850_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC25A11 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC25A11 (ARP43850_P050-Biotin) antibody is Catalog # AAP43850 (Previous Catalog # AAPS14311) |
| Reference | Kabe,Y., (2006) J. Biol. Chem. 281 (42), 31729-31735 |
|---|---|
| Gene Symbol | SLC25A11 |
| Gene Full Name | Solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 |
| Alias Symbols | OGC, PGL6, SLC20A4 |
| NCBI Gene Id | 8402 |
| Protein Name | Mitochondrial 2-oxoglutarate/malate carrier protein |
| Description of Target | SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism. |
| Uniprot ID | Q02978 |
| Protein Accession # | NP_003553 |
| Nucleotide Accession # | NM_003562 |
| Protein Size (# AA) | 314 |
| Molecular Weight | 34kDa |
| Protein Interactions | RAPGEF2; UBC; SUMO2; STAU1; SUZ12; RNF2; BMI1; FBXO6; FBXO46; FBXW4; ADRB2; CLN5; CLN3; MMS19; UBL4A; MDC1; ECT2; FLOT1; HDAC5; MYC; ICT1; CEBPA; CAMKK2; BABAM1; SLC25A11; COPA; CDKN1A; |
