SIRT4 Antibody - N-terminal region : Biotin

Katalog-Nummer ARP32452_P050-Biotin

Size : 100ul

Marke : Aviva Systems Biology

Weitere Informationen anfordern

Contact local distributor :


Telefonnummer : +1 850 650 7790

SIRT4 Antibody - N-terminal region : Biotin (ARP32452_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-SIRT4 (ARP32452_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SIRT4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-SIRT4 (ARP32452_P050-Biotin) antibody is Catalog # AAP32452 (Previous Catalog # AAPP03448)
ReferenceAhuja,N., (2007) J. Biol. Chem. 282 (46), 33583-33592
Gene SymbolSIRT4
Gene Full NameSirtuin 4
Alias SymbolsSIR2L4
NCBI Gene Id23409
Protein NameNAD-dependent protein deacetylase sirtuin-4
Description of TargetSIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Uniprot IDQ9Y6E7
Protein Accession #NP_036372
Nucleotide Accession #NM_012240
Protein Size (# AA)314
Molecular Weight35kDa
Protein InteractionsSKP2; Glud1; UBC; SIRT3; IDE; SLC25A6; SLC25A5;