NDNF Antibody - N-terminal region : FITC
Katalog-Nummer ARP68872_P050-FITC
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
NDNF Antibody - N-terminal region : FITC (ARP68872_P050-FITC)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-NDNF (ARP68872_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Pig, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDNF |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Human: 100%; Pig: 86%; Zebrafish: 76% |
| Peptide Sequence | Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NDNF (ARP68872_P050-FITC) antibody is Catalog # AAP68872 |
| Gene Symbol | NDNF |
|---|---|
| Alias Symbols | HH25, NORD, C4orf31 |
| NCBI Gene Id | 79625 |
| Protein Name | Protein NDNF |
| Description of Target | NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth. |
| Uniprot ID | Q8TB73 |
| Protein Accession # | NP_078850 |
| Nucleotide Accession # | NM_024574 |
| Protein Size (# AA) | 568 |
| Molecular Weight | 62kDa |
