Biotrend > LHX3 Antibody - middle region : FITC
LHX3 Antibody - middle region : FITC
Katalog-Nummer ARP32443_T100-FITC
Size : 100ul
Marke : Aviva Systems Biology
Weitere Informationen anfordern
Bitte melden Sie sich an, um diese Funktion zu nutzen.
Datasheets/Manuals | Printable datasheet for anti-LHX3 (ARP32443_T100-FITC) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | FITC: Fluorescein Isothiocyanate |
Application | WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LHX3 |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Guinea Pig: 87%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 93%; Zebrafish: 92% |
Peptide Sequence | Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-LHX3 (ARP32443_T100-FITC) antibody is Catalog # AAP32443 |
Reference | Yaden,B.C., et al., (2006) Endocrinology 147 (1), 324-337 |
---|---|
Gene Symbol | LHX3 |
Gene Full Name | LIM homeobox 3 |
Alias Symbols | LIM3, CPHD3, M2-LHX3 |
NCBI Gene Id | 8022 |
Protein Name | LIM/homeobox protein Lhx3 |
Description of Target | LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene. |
Uniprot ID | Q9UBR4 |
Protein Accession # | NP_835258 |
Nucleotide Accession # | NM_178138 |
Protein Size (# AA) | 397 |
Molecular Weight | 43kDa |
Protein Interactions | ISL2; IFT172; LDB1; CITED2; ISL1; RLIM; LMX1A; LHX1; |
- LHX3 Antibody - middle region (ARP33644_P050)Catalog #: ARP33644_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- LHX3 Antibody - middle region (ARP33643_T100)Catalog #: ARP33643_T100Species Tested: HumanApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- LHX3 Antibody - middle region (ARP32444_P050)Catalog #: ARP32444_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.