GRM6 Antibody - C-terminal region : Biotin
Katalog-Nummer ARP32597_P050-Biotin
Size : 100ul
Marke : Aviva Systems Biology
Contact local distributor :
Telefonnummer : +1 850 650 7790
GRM6 Antibody - C-terminal region : Biotin (ARP32597_P050-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-GRM6 (ARP32597_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GRM6 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: ITFSLTSLQVVGMIAWLGARPPHSVIDYEEQRTVDPEQARGVLKCDMSDL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GRM6 (ARP32597_P050-Biotin) antibody is Catalog # AAP32597 (Previous Catalog # AAPP03604) |
| Reference | Hashimoto,T., et al., (1997) Eur. J. Neurosci. 9 (6), 1226-1235 |
|---|---|
| Gene Symbol | GRM6 |
| Gene Full Name | Glutamate receptor, metabotropic 6 |
| Alias Symbols | mGlu6, CSNB1B, GPRC1F, MGLUR6 |
| NCBI Gene Id | 2916 |
| Protein Name | Metabotropic glutamate receptor 6 |
| Description of Target | L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. GRM6 is part of Group III which is linked to the inhibition of the cyclic AMP cascade. |
| Uniprot ID | O15303 |
| Protein Accession # | NP_000834 |
| Nucleotide Accession # | NM_000843 |
| Protein Size (# AA) | 877 |
| Molecular Weight | 95kDa |
| Protein Interactions | GNAO1; |
